Loading...
Statistics
Advertisement

Liegestühle mit Logo, Druck, Werbung, Logodruck, Angelo Raziborsky ...
www.inventorstrust.de/
Angelo Raziborsky, Importeur, Herstellung und Vertrieb von Liegestühle mit IDEEN/LOGO und Regiestühle, Liegestuhl mit Logo, Holzliegestühle mit Druck ...

Inventorstrust.de

Domain is redirected to: Raziborsky.de
Advertisement
Conversion Technology Metas Server
Inventorstrust.de is hosted in Germany . Inventorstrust.de doesn't use HTTPS protocol. Number of used technologies: 8. First technologies: CSS, Font Awesome, Html, Number of used javascripts: 8. First javascripts: Jquery.js, Jquery-migrate.min.js, Bootstrap.min.js, Number of used analytics tools: 1. First analytics tools: Google Analytics, Its server type is: Apache. Its CMS is: Wordpress.

Technologies in use by Inventorstrust.de

Technology

Number of occurences: 8
  • CSS
  • Font Awesome
  • Html
  • Html5
  • Javascript
  • jQuery
  • Php
  • Pingback

Advertisement

Javascripts

Number of occurences: 8
  • jquery.js
  • jquery-migrate.min.js
  • bootstrap.min.js
  • jquery.knob.js
  • smoothscroll.js
  • scrollReveal.js
  • zerif.js
  • wp-embed.min.js

Content Management System

Number of occurences: 1
  • Wordpress

Analytics

Number of occurences: 1
  • Google Analytics

Server Type

  • Apache

Powered by

  • PHP/5.6.24

Google Analytics ID

  • UA-33211712-3

Conversion rate optimization
visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Founded!
visitors Clickable email Founded!
visitors CTA (call to action) button Founded!
visitors List Founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - Inventorstrust.de

Missing HTTPS protocol.

    Meta - Inventorstrust.de

    Number of occurences: 5
    • Name:
      Content:
    • Name: viewport
      Content: width=device-width, initial-scale=1
    • Name: generator
      Content: WordPress 4.4.4
    • Name: description
      Content: Angelo Raziborsky, Importeur, Herstellung und Vertrieb von Liegestühle mit IDEEN/LOGO und Regiestühle, Liegestuhl mit Logo, Holzliegestühle mit Druck, Strandstühle mit Werbeaufdruck, Sonnenliegen, Deckchair, Buchenholz, Lasur, Natur
    • Name: Metatag
      Content: Sonnenschirme

    Server / Hosting

    • IP: 217.160.231.112
    • Latitude: 51.30
    • Longitude: 9.49
    • Country: Germany

    Rname

    • ns6.schlund.de
    • ns5.schlund.de
    • mx01.schlund.de
    • mx00.schlund.de

    Target

    • hostmaster.schlund.de

    HTTP Header Response

    HTTP/1.1 302 Found Content-Type: text/html; charset=iso-8859-1 Content-Length: 204 Date: Wed, 17 Aug 2016 23:01:23 GMT Server: Apache Location: http://raziborsky.de X-Cache: MISS from s_ub9 X-Cache-Lookup: MISS from s_ub9:80 Via: 1.1 s_ub9 (squid/3.5.20) Connection: keep-alive HTTP/1.1 200 OK Content-Type: text/html; charset=UTF-8 Date: Wed, 17 Aug 2016 23:01:24 GMT Server: Apache X-Powered-By: PHP/5.6.24 Link: ; rel="https://api.w.org/" X-Cache: MISS from s_ub9 X-Cache-Lookup: MISS from s_ub9:80 Transfer-Encoding: chunked Via: 1.1 s_ub9 (squid/3.5.20) Connection: keep-alive

    DNS

    host: inventorstrust.de
    1. class: IN
    2. ttl: 3600
    3. type: A
    4. ip: 217.160.231.112
    host: inventorstrust.de
    1. class: IN
    2. ttl: 172800
    3. type: NS
    4. target: ns6.schlund.de
    host: inventorstrust.de
    1. class: IN
    2. ttl: 172800
    3. type: NS
    4. target: ns5.schlund.de
    host: inventorstrust.de
    1. class: IN
    2. ttl: 86400
    3. type: SOA
    4. mname: ns5.schlund.de
    5. rname: hostmaster.schlund.de
    6. serial: 2016041800
    7. refresh: 28800
    8. retry: 7200
    9. expire: 604800
    10. minimum-ttl: 600
    host: inventorstrust.de
    1. class: IN
    2. ttl: 3600
    3. type: MX
    4. pri: 10
    5. target: mx01.schlund.de
    host: inventorstrust.de
    1. class: IN
    2. ttl: 3600
    3. type: MX
    4. pri: 10
    5. target: mx00.schlund.de

    Common Typos/Mistakes

    This list shows You some spelling mistakes at internet search for this domain.

    www.nventorstrust.de, www.irnventorstrust.de, www.rnventorstrust.de, www.ifnventorstrust.de, www.fnventorstrust.de, www.ivnventorstrust.de, www.vnventorstrust.de, www.iknventorstrust.de, www.knventorstrust.de, www.i,nventorstrust.de, www.,nventorstrust.de, www.ibnventorstrust.de, www.bnventorstrust.de, www.ignventorstrust.de, www.gnventorstrust.de, www.itnventorstrust.de, www.tnventorstrust.de, www.iynventorstrust.de, www.ynventorstrust.de, www.iunventorstrust.de, www.unventorstrust.de, www.ijnventorstrust.de, www.jnventorstrust.de, www.imnventorstrust.de, www.mnventorstrust.de, www.innventorstrust.de, www.nnventorstrust.de, www.iventorstrust.de, www.innventorstrust.de, www.inventorstrust.de, www.inhventorstrust.de, www.ihventorstrust.de, www.injventorstrust.de, www.ijventorstrust.de, www.inkventorstrust.de, www.ikventorstrust.de, www.inlventorstrust.de, www.ilventorstrust.de, www.in ventorstrust.de, www.i ventorstrust.de, www.inentorstrust.de, www.invyentorstrust.de, www.inyentorstrust.de, www.invzentorstrust.de, www.inzentorstrust.de, www.invhentorstrust.de, www.inhentorstrust.de, www.invnentorstrust.de, www.innentorstrust.de, www.invmentorstrust.de, www.inmentorstrust.de, www.invjentorstrust.de, www.injentorstrust.de, www.invkentorstrust.de, www.inkentorstrust.de, www.invientorstrust.de, www.inientorstrust.de, www.invntorstrust.de, www.invexntorstrust.de, www.invxntorstrust.de, www.invesntorstrust.de, www.invsntorstrust.de, www.invewntorstrust.de, www.invwntorstrust.de, www.inverntorstrust.de, www.invrntorstrust.de, www.invefntorstrust.de, www.invfntorstrust.de, www.invevntorstrust.de, www.invvntorstrust.de, www.invecntorstrust.de, www.invcntorstrust.de, www.inveqntorstrust.de, www.invqntorstrust.de, www.inveantorstrust.de, www.invantorstrust.de, www.inveyntorstrust.de, www.invyntorstrust.de, www.invetorstrust.de, www.invenntorstrust.de, www.inventorstrust.de, www.invenhtorstrust.de, www.invehtorstrust.de, www.invenjtorstrust.de, www.invejtorstrust.de, www.invenktorstrust.de, www.invektorstrust.de, www.invenltorstrust.de, www.inveltorstrust.de, www.inven torstrust.de, www.inve torstrust.de, www.invenorstrust.de, www.inventqorstrust.de, www.invenqorstrust.de, www.inventaorstrust.de, www.invenaorstrust.de, www.invent orstrust.de, www.inven orstrust.de, www.inventworstrust.de, www.invenworstrust.de, www.inventeorstrust.de, www.inveneorstrust.de, www.inventzorstrust.de, www.invenzorstrust.de, www.inventxorstrust.de, www.invenxorstrust.de, www.inventcorstrust.de, www.invencorstrust.de, www.inventrstrust.de, www.inventobrstrust.de, www.inventbrstrust.de, www.inventohrstrust.de, www.inventhrstrust.de, www.inventogrstrust.de, www.inventgrstrust.de, www.inventojrstrust.de, www.inventjrstrust.de, www.inventomrstrust.de, www.inventmrstrust.de, www.invento rstrust.de, www.invent rstrust.de, www.inventovrstrust.de, www.inventvrstrust.de, www.inventostrust.de, www.inventoristrust.de, www.inventoistrust.de, www.inventorostrust.de, www.inventoostrust.de, www.inventorlstrust.de, www.inventolstrust.de, www.inventorlstrust.de, www.inventolstrust.de, www.inventor.strust.de, www.invento.strust.de, www.inventortrust.de, www.inventorsetrust.de, www.inventoretrust.de, www.inventorswtrust.de, www.inventorwtrust.de, www.inventorsdtrust.de, www.inventordtrust.de, www.inventorsxtrust.de, www.inventorxtrust.de, www.inventorsftrust.de, www.inventorftrust.de, www.inventorsgtrust.de, www.inventorgtrust.de, www.inventorsttrust.de, www.inventorttrust.de, www.inventorsrust.de, www.inventorstqrust.de, www.inventorsqrust.de, www.inventorstarust.de, www.inventorsarust.de, www.inventorst rust.de, www.inventors rust.de, www.inventorstwrust.de, www.inventorswrust.de, www.inventorsterust.de, www.inventorserust.de, www.inventorstzrust.de, www.inventorszrust.de, www.inventorstxrust.de, www.inventorsxrust.de, www.inventorstcrust.de, www.inventorscrust.de,

    Other websites we recently analyzed

    1. Stellar Publishing e-Store
      Houston (United States) - 192.185.170.161
      Server software: nginx/1.10.1
      Technology: Html, Php
      Number of meta tags: 1
    2. DPMCUSA | Best Credit Repair | New York | New Jersey | Pennsylvania
      Best Credit Repair Serving New York Buffalo Albany Jersey City Newark Pittsburgh & Philadelphia. Services Nationwide. Get the Best Results. A+ Rating.
      Burlington (United States) - 66.96.161.132
      Server software: Apache/2
      Technology: CSS, Google Font API, Javascript
      Number of Javascript: 3
      Number of meta tags: 5
    3. Willkommen bei PPE-Trading
      Zurich (Switzerland) - 217.26.52.41
      Server software: Apache/2.4
      Technology: CSS, Html
      Number of meta tags: 10
    4. J Collins Kerr | www.jcollinskerr.com | Home
      Beaverton (United States) - 67.51.200.171
      Server software:
      Technology: CSS, Html, Javascript, jQuery UI, Share This Social Media Buttons
      Number of Javascript: 9
      Number of meta tags: 3
    5. valentinesdaywishesmessagespics.com
      Scottsdale (United States) - 104.238.72.112
      Server software: Apache/2.2.31 (Unix) mod_ssl/2.2.31 OpenSSL/1.0.1e-fips mod_bwlimited/1.4
      Technology: Html
      Number of meta tags: 1
    6. Kumruoğlu Nakliyat Lojistik Ambarcılık - www.kumruoglu.com.tr
      Kumruoğlu Nakliyat Lojistik Ambarcılık
      Turkey - 94.73.147.80
      Server software: nginx/1.1.19
      Technology: CSS, Flexslider, Font Awesome, Google Font API, Html, Html5, Javascript, jQuery UI
      Number of Javascript: 21
      Number of meta tags: 2
    7. giovannimurray.com
      Wayne (United States) - 74.208.165.84
      Server software: Apache
      Technology: Html
      Number of meta tags: 1
    8. W-Didacte.be
      Denmark - 46.30.212.21
      Server software: Apache
      Technology: Html
      Number of meta tags: 1
    9. your-coaching-concept.net
      Hier entsteht
      Germany - 89.31.143.16
      Server software: Apache
      Technology: CSS, Html, SVG
      Number of meta tags: 3
    10. express-airports.com
      United Kingdom - 81.21.76.62
      Server software: Apache/2.2.3 (CentOS)
      Technology: CSS, Html, Javascript, Php
      Number of Javascript: 1
      Number of meta tags: 1

    Check Other Websites